SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00030031m|PACid:23765632 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00030031m|PACid:23765632
Domain Number 1 Region: 127-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.05e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.053
Further Details:      
 
Domain Number 2 Region: 247-326
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000478
Family Glutathione S-transferase (GST), N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00030031m|PACid:23765632
Sequence length 327
Sequence
MLHLTHPARHPSLRSAPPRRAPPPARARLPNCLPRARTTLARARPPSAGAAETETASTSG
GGGGGGSVLSFLCPLLKLLGGGDPSRERNDFVEVMTSSISSLARLPWGSKVATSSGDSTG
PAASVPNLQLYEFEACPFCRRVREAMTELDLSAEVYPCPKGSRRHREMVKKIGGKEQFPL
LVDASTGVTMYESGDIVNYLFRQYGQGRSPSSGLLESTIFTGWVPTLLRTGRGMTLWNNA
GVVPAEKLELFSYENNSYARIVREALCELELPYVLQNVGEGSSKMDALLRISGSKQVPYL
IDLNTGFQSGDYKKILSYLFQQYAISS
Download sequence
Identical sequences Pavirv00030031m|PACid:23765632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]