SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00030243m|PACid:23809777 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00030243m|PACid:23809777
Domain Number 1 Region: 246-659
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.02e-72
Family N-acylglucosamine (NAG) epimerase 0.07
Further Details:      
 
Domain Number 2 Region: 75-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.53e-31
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00030243m|PACid:23809777
Sequence length 751
Sequence
MSPAASAPVFSHLPRPLTLPPTPMLSTLLLRHRLTAAAAAAASSPTRSPLRVLAAAAGMS
SSASASSSSPHGGRKPNRLAAEHSPYLLQHAHNPVDWYPWGDEAFEKARAKDVPIFLSIG
YSTCHWCHVMEVESFENEEVAKLLNDWFVSIKVDREERPDVDKVYMAYVSALHGGGGWPL
SVFLSPNLKPLMGGTYFPPDDKYGRPGFKTVLRKVKEAWETKRDALERTGNLVIEQLTDA
LSAKASLQDLPNDLADVCVDQCVEKLASSYDPKFGGFGSAPKFPRPVEDYIMLYRFRKLM
EAGKESEAKNIKKMVTHTLDCMARGGVHDHVGGGFHRYSVDECWHVPHFEKMLYDQGQIV
NVYLDTFLITGDEYYSTVARDILDHLRRDMIGKEGEIFSAEDADSAEYEDAPRKKEGAFY
VWTSKEIEDALGENAELFKNHYYVKSSGNCDLSPMSDPHNEFNGKNVLIERKPASLMASK
SGNSLDEYSQILGACRQKLFDIRSKRPRPHLDDKVIVSWNGLAISAFARASQILKLGQSG
SRFNFPVVGCNPVEYLEVAEKAANFIKVKLYDASSKRLHHSYRNGPSKAPGFLDDYAFLI
NGLLDLYEFGGKIEWLLWAIQLQVTQDELFLDKQGGGYFNTPGEDPSVLLRVKEDYDGAE
PSGNSVAAINLIRLSSILDAAKSTGYKRNVEHLLAVFETRLRQLSIALPLMCCAADMLSV
PSRKQVVLVGGERICRIPGHGSSYIFIIRSE
Download sequence
Identical sequences Pavirv00030243m|PACid:23809777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]