SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00031514m|PACid:23791144 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00031514m|PACid:23791144
Domain Number 1 Region: 93-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.6e-30
Family Selenoprotein W-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00031514m|PACid:23791144
Sequence length 189
Sequence
MAQQQEINCKSRPYVGRGRSQREARRMMDRSLSVAAAVAAVALLCFSGLCHGERLGAREC
EDLGFTGLALCSDCNALSEFVKDQELVEDCRKCCTEDSDDSISKLTFSGAIIEVCMRKLV
FYPEVVGFLEEDKDDFPYVEARYLYGSPPKLIMLDDKGEQKETIRIDNWKREHIRQFLKE
KVKLVKSDS
Download sequence
Identical sequences Pavirv00031514m|PACid:23791144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]