SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00031934m|PACid:23798242 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00031934m|PACid:23798242
Domain Number 1 Region: 77-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-29
Family Thioltransferase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00031934m|PACid:23798242
Sequence length 187
Sequence
MRRLVSTALVARGLVRSCRAPTTAAVSQPAFQQFMNYSSGHGGDPNANGDSTVTRIAIDR
DTHQDFKPTSKNLDTSLHDIVAQDIRENPVLIYMKGFPESPMCGFSALAVKVFQQYDVPI
CGRDILGDLRLKEAVKAHTNWPTFPQIFIKGEFVGGSDIILSMHQKGELKDLLGDITQRD
GQKADAN
Download sequence
Identical sequences Pavirv00031934m|PACid:23798242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]