SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00032976m|PACid:23810336 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00032976m|PACid:23810336
Domain Number 1 Region: 163-295
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.84e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 80-168
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.83e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00032976m|PACid:23810336
Sequence length 298
Sequence
MNSLAFPRCGPSPLTPASTSTSAPVTTDAPPARIKIRRPRREAHRIAAQKPSRIVAMAAA
APASFVKEVLPSPLTSVSEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDKIKIVAI
DLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDSNFEGPSLLPDDPAKKQFAE
ELLAFTDAFNRALYSSIVSKEDVSEETVAALDKIEEALGKFTDGPFFLGQFSLVDIAYVP
FIERFQIFFQNIKNYDITKGRPDLQRFIEEVNKIDAYTQTKQDPQFLLEHTKKRLGIA
Download sequence
Identical sequences Pavirv00032976m|PACid:23810336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]