SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00032992m|PACid:23766379 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00032992m|PACid:23766379
Domain Number 1 Region: 76-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-34
Family PDI-like 0.00062
Further Details:      
 
Domain Number 2 Region: 292-422
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.95e-22
Family PDI-like 0.0027
Further Details:      
 
Domain Number 3 Region: 421-492
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.14e-18
Family PDI-like 0.0029
Further Details:      
 
Domain Number 4 Region: 199-304
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000302
Family PDI-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00032992m|PACid:23766379
Sequence length 500
Sequence
MAMAPRSLAALLLLLLFAAAAYPSTRAAATTSSSKDEEEDLQYLIDDAGDIPDNGPDGDG
DYDDLFEDQDLPDQQPHIDETRVVVLTAANFSSFLAATRHVMVEFYAPWCGHCQELAPDY
AAAASHLAAHHSQSHLALAKVDATEDTDLAHKYDVQGFPTILFFIDGVPKDYNGARTKDA
IVEWINKKLGPGVQNITAVDQAERILTGDDKAVLAFLDSLSGAQSDELAAASRLEDSVNF
YQTSSPDVAKLFHIDPAAKRPCVVLLKKEEEKLTFFDGEFKASVIADFVSANKLPLVTTL
TQETSPSIFGNSIKKQILLFAVANKSSKFLPIFKEAAKSFKRKLLFIFVERDNEEVGEPV
ANYFGITGQETTVLAYTGNEDARKFFFDGEVSLDSIKDFAESFLEDKLTPFYKSEPVPES
NDGDIKIVVGKNLDLIVLDESKDVLLEIYAPWCGHCQSLEPTYNKLAKHLRGIDSLVIAK
MDGTSNEHPRAKVCITAFVG
Download sequence
Identical sequences Pavirv00032992m|PACid:23766379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]