SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00033360m|PACid:23821924 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00033360m|PACid:23821924
Domain Number 1 Region: 170-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000572
Family Thioltransferase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00033360m|PACid:23821924
Sequence length 261
Sequence
MHNGLDLFHLTGIPLPLVGLVAYGLATALSLQENGTDLLPGFDDLDIQLTLLLIATSMAT
ASAYFLYILSTKFVGVSCSYCLLSAALSFTLLFIRVKDFGFERIKKFAGIQLAVAVIIAL
ALTNSYSSATTQLKGTDDFVLEPYETEITTESSPFAIALARHLHSIGAKMYGAFWCSHCN
EQKQMFGREATKILDYVECFPNGAGKGKKMTSECQAAGLEGFPTWFINGKVLSGDQELEV
LAEASGFVAEGTEQSKEIAPN
Download sequence
Identical sequences Pavirv00033360m|PACid:23821924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]