SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00035033m|PACid:23797849 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00035033m|PACid:23797849
Domain Number 1 Region: 81-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-36
Family Thioltransferase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00035033m|PACid:23797849
Sequence length 188
Sequence
MAGAGLAVPVPVASPPLARASASAYTGTARRVCAIPSSPSFSSSSSFRSSPLRATAGFSG
NRRRPCRGASVACRQGQDTTIEVPDVTKTTWQSLVMESELPVLVEFWASWCGPCKMIDPV
VGKLSKDYEGKLKCYKLNTDESPDIASQYGIRSIPTMMIFKNGEKKDSVIGAVPESTLIA
CIDKFVER
Download sequence
Identical sequences Pavirv00035033m|PACid:23797849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]