SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00036452m|PACid:23826140 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00036452m|PACid:23826140
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.28e-20
Family Glutathione peroxidase-like 0.0000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00036452m|PACid:23826140
Sequence length 110
Sequence
MQHVPGFIAQAEQLKAKGVDEILLISVNDPFVMKAWAKTYPENKHVKFLADGSGNYTKAL
GLELDLTEKGLGIRSRRFALLADNLKVTVANIEEGGQFTISGAEEILKAL
Download sequence
Identical sequences Pavirv00036452m|PACid:23826140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]