SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00036532m|PACid:23810529 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00036532m|PACid:23810529
Domain Number 1 Region: 174-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000847
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 2 Region: 266-298
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000222
Family CCCH zinc finger 0.0013
Further Details:      
 
Domain Number 3 Region: 103-134
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000693
Family CCCH zinc finger 0.003
Further Details:      
 
Domain Number 4 Region: 38-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000288
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00036532m|PACid:23810529
Sequence length 302
Sequence
MEGAAAARKRSRPETANGAAAGGKRSKETESFQTGQSSKSKPCTKFFSTIGCPFGEGCHF
LHFVPGGYPAVAKMLNLGSPAVSAPARAPADHAAVANSHPASMGKTRMCTKYNTVEGCRF
GDKCHFAHSERELGKPAYMTHEAPPMGGRFGGRPEPPPPVAMGPPAGNFGASATAKISVD
ASLAGGIIGKGGVNTKQICRVTGVKLSIRDHESDPNLKNIELEGNFDQIKQASNMVSDLI
ATISASMPPKNPAPAGGRGGAPGGRSNYKTKLCENFVKGGTCTFGERCHFAHGENEQRRG
AA
Download sequence
Identical sequences Pavirv00036532m|PACid:23810529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]