SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00037230m|PACid:23801354 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00037230m|PACid:23801354
Domain Number 1 Region: 86-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.38e-20
Family Thioltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00037230m|PACid:23801354
Sequence length 236
Sequence
MWSPWVRRSKASGRLTQSPSFSAPTAPSPTGKDYQGISAILDDAAPDSGTGSPGKIVLHR
ARSASRLRTCKSFAAAAEAAAAAVAGERRVVLYFTSLRAVRGTFEDCRTVRTILRGLRVA
VDERDVSMDAAYLAELRALMRRDRPPLPQLFVGGRLVGDAEEVRLLHESGELRRVLAGAA
QAAPTPCASCGGSRFVPCGACCGSHRRFSEKTGGFRVCASCNENGLVRCAACSSSS
Download sequence
Identical sequences Pavirv00037230m|PACid:23801354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]