SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00037708m|PACid:23765072 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00037708m|PACid:23765072
Domain Number 1 Region: 206-327
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 3.79e-23
Family Elongation factor TFIIS domain 2 0.004
Further Details:      
 
Domain Number 2 Region: 336-395
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.48e-19
Family Transcriptional factor domain 0.0012
Further Details:      
 
Domain Number 3 Region: 24-98
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2.35e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00037708m|PACid:23765072
Sequence length 397
Sequence
MERELLETFEAAKKAADAAAGEDDSPEADRCLDALRRLRDIRVNTDVLVATQVGKRLRHL
TKHPHSGIQAVATDLFGYWKKVVLEETGKKNGSSENERSSDSSGKIEKARPVKIERNSSS
SSMKVERSSDSSGKIEKARPVKIERNSSSASMKVEKRDVDVKGQRPDSVKIEKATSNGSK
AQPVKVERVSKEVSRTPDTKKTASVPTGPPKLTSLVKCNDATRDKIRELLAEAFSKVPAE
TSNDDRDEVRSILDQVNACDPFRVAVTVESALFEKLGRSTGAQKAKYRSIMFNLRADNNT
DFRRRVLIGQVRPERLPDIPPEEMASDARKQENKQIKAKAMFDCERGGAPKATTDQFKCG
RCGQRKTTYYQLQTRSADEPMTTFVTCVNCNNHWKFC
Download sequence
Identical sequences Pavirv00037708m|PACid:23765072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]