SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00039625m|PACid:23822882 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00039625m|PACid:23822882
Domain Number 1 Region: 67-209
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-30
Family UAS domain 0.052
Further Details:      
 
Domain Number 2 Region: 308-390
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-23
Family UBX domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00039625m|PACid:23822882
Sequence length 392
Sequence
MSSGPARGSSSAGESLRNSCNDFARTLARLPASIMEGLSRSIPRRRSHHPVPHRLQPPPQ
APPLLPPPFVPEELFFFSVFEQQYGAHHPFFYACRFADALRAARREGKLVFVYLHDPGHP
YTEPFCRRTLCSDVVVEFLDANFVSWGAVSGTGEGPGMVASLQPGSFPFCAVVAPVSDES
IAVLQQVEGPVSPSELVEILQRTIDEQGAAFRASRPDEQAAAVRSARTAEEEERRRSALR
LRQEQDAAYLESLRRDQEKERSRKSLQEGTAKPRAGNQLRPRHPGQAARQPTKPTQIRAS
PQKETAASPRTEPNTKIMIRFPNGERRQQSFRHTDTIRDVYRYVDSLGIPGIGSYQLVRS
YPRKTYGQQQLGMTLGDAGFYPSVTLYIEQLS
Download sequence
Identical sequences Pavirv00039625m|PACid:23822882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]