SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00044053m|PACid:23806076 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00044053m|PACid:23806076
Domain Number 1 Region: 82-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.84e-28
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00044053m|PACid:23806076
Sequence length 190
Sequence
MAMATAAAVLPSCAAGPLSRAPAPLPRLLLSIQPSPARRDGSRGCSLASASGSRAPTVRR
NAAAETVVPYVPGSGKYIAPDYLVKKVSAKEVEELVKRERNVPLIVDFYATWCGPCVQMA
QDIEMLAVEYEDNALFVKVDTDDEYEFAKDMQVRGLPTLYFFSPDQSKEAIRTEGLIPMD
MIRSIIDNEL
Download sequence
Identical sequences Pavirv00044053m|PACid:23806076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]