SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00046264m|PACid:23758914 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00046264m|PACid:23758914
Domain Number 1 Region: 777-922
Classification Level Classification E-value
Superfamily VC0467-like 1.44e-23
Family VC0467-like 0.00082
Further Details:      
 
Domain Number 2 Region: 598-726
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000229
Family PDI-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00046264m|PACid:23758914
Sequence length 933
Sequence
MQKFHQFESFYAKLTAIARESFLPPEIARFGLITEKSLLPSLDVVNEGNPETWFVVTHYL
GCTTCSIIVKDGDDLGNIVQSHHILGIKEVGADESGGKAIFPTNRPSIILFIDRLSHSSK
VRDESKFVIKLLRQYVQNNYPFHVSTRVLSSGTSKTISEVVDSLRNTGISDSHSESGRLS
AWASKLMALGDKMSVMVVNDGDNILYRTSSHDSGSNPLYDVLTKLLHKTRPGHRLKKTRI
NLVTKDVGPNMLSDDSKIQVVNSLSAQESEYKRVHNSVVTSDNSNDDIAEVSVDENTAEE
TEYIDDGQAPSILEKTPATYPYENDNDNDNDLESDVAEVEDQSKSEASDMSPDLQEDVSF
NAYSSGEVEGILHKRIVEKTVTETFESDERNMHADQEESVSSNEQDDGSSVLDKKFRKNE
NVIYEENTCNLHEGSEESDTRCPHHATCSSSCSPVKDDTNFTEHVTSSISDDRFAGSFYF
SDGGYRLLKTLTGGSRIPSLVIIDPVEQKHYVFPEEIEYSYASLQNYLDSFTNGSLPSYY
HVTSLAISSKELPRPPFVNHDFHEANSIPQLTTNSFCPLVFGSAGCDSKSEVPFSNTENL
SSGWNKDVMVLFSNSWCGFCQRAELVVRELHRSFKSFSSYSDSSSANAQDVQVHAEGKNE
KYAMKGFPVIYMIDCPSNECHHLLKSAGMEELYPTLLLFPAENKSAIAYEGGMSVAHLIE
FLESHVSNSRHLLEYKGYMWKKRMATQQDAPQAIQFHISDKGSGSVGSDLPNHSDVITGS
ILTATDKLGTTVPFDNAKVLIVSSDSHGGFHGLIINKRLSWGIFKNLDSSMEPIKYAPLF
YGGPVVVQGYHLVSLSRVAWEGYMQVIPGVYYGNIIATSRVVTRIKSGEQSVDDLWFFLG
YSGWGYNQLLDELSEGAWLVSVKPIEHLDWPET
Download sequence
Identical sequences Pavirv00046264m|PACid:23758914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]