SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00047057m|PACid:23777613 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00047057m|PACid:23777613
Domain Number 1 Region: 215-311
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000831
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00047057m|PACid:23777613
Sequence length 381
Sequence
MGCWGSKAGADVAVADAYRPPPTSVSVFDISAVEEPWLIAKNKAAGDEEDDDQEEEETDE
DDDEEEKKNVVPLRLPLLEKLEGYELAPASWSEVSKALEDMKPEMLLDSNTNKPPDPKKK
TAKKKKKKTNKEEEEEPAADAQTQEQKLQPPPDEEVGKKSPPPPPPPELAGRRVVKDNPF
LMRDRESSSKAGNAPRWKRRDPFEGCPERRPPGAAGGGVVLYTTTLHGVRRTFEDCERAR
EVVEACAEAAGVGAVDERDVSLHGEYLRELRELAGDGAAAPPRLFVMGRYVGGAEECVRL
AESGRLREMMRWVKARGEACAAKDGRGCEGCGGARFVPCWECGGSRRKLVVVEGGGGGHQ
DQVERCAKCNENGLMMCPLCH
Download sequence
Identical sequences Pavirv00047057m|PACid:23777613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]