SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00047954m|PACid:23774354 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00047954m|PACid:23774354
Domain Number 1 Region: 122-187
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.5e-20
Family DNA-binding domain from rap30 0.0045
Further Details:      
 
Domain Number 2 Region: 3-52
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000259
Family Rap30/74 interaction domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00047954m|PACid:23774354
Sequence length 195
Sequence
MEMAQTNNGNTPKSYSLNMYNDFVPMCIFSESNQGKYACEGKVENKFDMKPHSENLAEYG
KLCRERTTKCMAKPRRVEVLADDHGSRMRPMPGMVGLMPSSATNAKEKKKPVPPRSFETK
RTRRGRTEMENILFKLFERQPNWSLKQLMQETDQPEQFLKEILNDLCVYNKRGPNQGTHE
LKPEYKKSTEDNNAT
Download sequence
Identical sequences Pavirv00047954m|PACid:23774354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]