SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00049654m|PACid:23816008 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00049654m|PACid:23816008
Domain Number 1 Region: 15-119,147-278
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 1.75e-48
Family Plant cytotoxins 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00049654m|PACid:23816008
Sequence length 296
Sequence
MAANPPPSATNPLFTVTFDVKSSDNYGDFIAGIRRRVANPRHFSHNRPVLPPVEPPPRRW
FHIVLRTQTATLTLATRADNLYLEGFRSSDGTWWELTRGLIPGATYLGFGGSYGDLLGNT
FRLAEVALGRLGPQQKADAAKKLAARARLGLAGVELGPQQMADAANALAARARGDLASGK
EQQRASEALLVILLMVHEATRFATVSAFVAALMHPTAAMKRGTITAQMKEQVNGWEDLSK
SLLQADAVRPPGPFKPFPKMGVRTVEEAAATIGILLFVEVPGGMTAATALQLFHGN
Download sequence
Identical sequences Pavirv00049654m|PACid:23816008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]