SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00049929m|PACid:23765669 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00049929m|PACid:23765669
Domain Number 1 Region: 81-189
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000301
Family Glutathione peroxidase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00049929m|PACid:23765669
Sequence length 259
Sequence
MAARAPLAMPHAAAAADPRPAGAPVAPRPTAPCLRARGTSGVPLLHQRPVQRAHRLLLPA
ARPGAIGSAAEAAPAEGLAQKLQGVEVFDLSGKAVPIVDLWKDRKAVIAFARHFGCVLCR
KKADLLAEKQDVMQTAGVALILIGPGSVEQANAFCEQTKFKGEVYADPTHSSYDALEFAF
GLFSTFTPAAGLKIIQLYREGYRQDWELSFEKNTRTKGGWYQGGLLVAGPGIDNILYIHK
DKEAGDDPDMQDVLRACCP
Download sequence
Identical sequences Pavirv00049929m|PACid:23765669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]