SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00050689m|PACid:23784250 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00050689m|PACid:23784250
Domain Number 1 Region: 257-417
Classification Level Classification E-value
Superfamily eEF1-gamma domain 3.66e-61
Family eEF1-gamma domain 0.000049
Further Details:      
 
Domain Number 2 Region: 73-214
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.43e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0044
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00050689m|PACid:23784250
Sequence length 417
Sequence
MALVLHSGPGNKNAFKALIAAEYSGVKIELTKNFEMGVTNKTPEFLKMNPLGKVPVLETP
EGAVFESHAIARYVARLNDGNPLFGSSRIEQAHVEQWMDFAATEVDPGVAWYLYPRLGYI
PYSQTTEETAIASLKRALGSLNTHLASKTFLVGHSVTLADIVLTCNLYHGFARILTKSFT
SEFPHVERYFWTMVNQPNFKKVMGDVKQAESVPPVPKKVAAPKEPKAKDVKKEAPKEAPK
PKVVEAPAEEEVPKPKPKNPLDLLPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPE
GYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLF
RGQEVPKFVMDEVYDMELYEWTKVDISDEAQRERVSAMIEDQEPFEGEALLDAKCFK
Download sequence
Identical sequences Pavirv00050689m|PACid:23784250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]