SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00053038m|PACid:23787936 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00053038m|PACid:23787936
Domain Number 1 Region: 97-171
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000051
Family PDI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00053038m|PACid:23787936
Sequence length 179
Sequence
ELSSYLAVNTTTSVIVDRSSDGEFLRIDFNISFPALSCEFASVDVSDVLGTNRLNITKTV
RKYSIDRNLVPTGSEFHPGPIPTVSKHGDDIEEDHVDGSVSLSSRNFDSYSHQYPVLVVN
FYAPWCYWSNRLKPSWEKTAQIIRERYDPEMDGRILLGKVDCTEEIDLCRRSVPIDTYI
Download sequence
Identical sequences Pavirv00053038m|PACid:23787936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]