SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00054784m|PACid:23792122 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00054784m|PACid:23792122
Domain Number 1 Region: 183-272
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.4e-25
Family Thioltransferase 0.00079
Further Details:      
 
Weak hits

Sequence:  Pavirv00054784m|PACid:23792122
Domain Number - Region: 82-117
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0418
Family GIY-YIG endonuclease 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00054784m|PACid:23792122
Sequence length 273
Sequence
SIHGVLHRCFSPPRLPSPLRPRRRGLLGSSFSSATTLRFPHRRAPRRLAVAAFKKLSEAS
PVPIPPEPTQPLLDEGALPPNPGVYGVYDASGDLQFVGISRNVRASLEGHRQKAPADLCA
SVKTPDRAVLTNAWKSWMEEHIESTGKAPPGNVAGNNTWVGAPQRPPDLRLTPGRHVQLT
VPLEQLIDRLVKENKVVAFIKGSRSAPQCGFSQRVVGILEAHGVDFVTVDVLDEEHNHGL
RETLKSYSNWPTFPLVFVGGELVGGCDIVSSMV
Download sequence
Identical sequences Pavirv00054784m|PACid:23792122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]