SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00055073m|PACid:23824240 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00055073m|PACid:23824240
Domain Number 1 Region: 60-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.38e-44
Family Glutathione peroxidase-like 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00055073m|PACid:23824240
Sequence length 243
Sequence
MAVAGARASVLLPSTLAACTSPRPRLLALQLRHRRPRGSLASAPAAGRGRLRVRMARTES
TGVAVGFRAPQFELPEPLTGKLWTLDDFEGNPALLVMFICNHCPFVKHLKKDIAKLTSFY
MEKGLGAVAISSNSIRTHPQDGPERMAEDAKLFEYPFPYLYDESQEVAKAFGAVCTPEFF
LFKKDGRRPFELFYHGQFDDSRPSNNVPVTGRDLSRAIDCALSGQELPFVQKPSVGCSIK
WHP
Download sequence
Identical sequences Pavirv00055073m|PACid:23824240 Pavirv00055074m|PACid:23824239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]