SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00055371m|PACid:23796146 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00055371m|PACid:23796146
Domain Number 1 Region: 185-291
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-19
Family Thioltransferase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00055371m|PACid:23796146
Sequence length 352
Sequence
MGGLRSRILRTLQSFPKAATQSNILLALPPAAGSSPAPAASCAHLQEPAPQEKVPADEAG
AAAHEVPGGGADDDGDKENVSPGVTPRKAKKMKLSSDHRDVSAAGPGEPAGAGCYRRPDL
ASVTLFDPDLLAAFRRAVDAYAQALEVASRRDDIDDGDGVPGGGEGGGGEAAGVADPLEA
FERRCPPGGERAVVLYTTSLRGVRKTFEDCARVRRLLEGLRVAFLERDVSMHAPYREELR
ALVCDHDGPCASGLAAAFPVPPRLFVDGRYLGGADEVVALHERSQLRPVLRRAPRRGAGD
GPCAFCGGAWFVVCGGCSGSHWLHDATVTTAASRVPCSACNENGLVPCPLCS
Download sequence
Identical sequences Pavirv00055371m|PACid:23796146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]