SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00055760m|PACid:23809538 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00055760m|PACid:23809538
Domain Number 1 Region: 72-228
Classification Level Classification E-value
Superfamily Thioredoxin-like 8e-60
Family Glutathione peroxidase-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00055760m|PACid:23809538
Sequence length 230
Sequence
MAPATATAAFTSLLPAGASRLPSAAAAAGAAASFVRLPRHPTGWAGASVAAPRTARRRAP
GVAYATAATEKSIYDYTVKDIDGKDVPLKKFKNKVLLIVNVASQCGLTTANYTELSHIYE
KYKTQGFEILAFPCNQFGAQEPGSNSQIKQFACTRFKAEFPIFDKVDVNGPNTAPIYKFL
KSSAGGFLGDLVKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLIAA
Download sequence
Identical sequences Pavirv00055760m|PACid:23809538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]