SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00056817m|PACid:23806354 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00056817m|PACid:23806354
Domain Number 1 Region: 50-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-53
Family Glutathione peroxidase-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00056817m|PACid:23806354
Sequence length 186
Sequence
ARKRLHEKNQIRRRRFERAPPGREGKRRRRGGARRCRGGMGAVESVPETSIHEFTIKDCN
GKEVSLETYKGKVLLVVNVASKCGFTETNYTQLTELYQKYRDKDFEILAFPCNQFLRQEP
GTAEQAKDFACTRFKAEYPVFQKVRVNGPDAAPVYKFLKASKPGLFGSRIKWNFTKFLVD
KNGKVI
Download sequence
Identical sequences Pavirv00056817m|PACid:23806354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]