SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00057039m|PACid:23813119 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00057039m|PACid:23813119
Domain Number 1 Region: 27-73,106-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000687
Family Thioltransferase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00057039m|PACid:23813119
Sequence length 233
Sequence
MASPRLPLLLRLAPLVLLCLCLSPVCAAGRVPVSVYYETLCPFCSAFVVNDLARIFHDGV
SSITDLRLVPFGNGRVSADGSITCQHGEGECQLNAIEACVIRLWPNAEQHFPFVQCVEHL
ALTRKWDAWQSCFQETGLASQPVIDCYNSGYGRQLELQNAAETNALQPPHQFVPWVVVNG
KPLGEDYMNFEAYICSVYDGKLPEACKGKHLAIAQHTRASGGDKVCPVRKIIS
Download sequence
Identical sequences Pavirv00057039m|PACid:23813119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]