SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00057581m|PACid:23757686 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00057581m|PACid:23757686
Domain Number 1 Region: 224-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.1e-30
Family Thioltransferase 0.00058
Further Details:      
 
Weak hits

Sequence:  Pavirv00057581m|PACid:23757686
Domain Number - Region: 56-160
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00199
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 115-153
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0183
Family GIY-YIG endonuclease 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00057581m|PACid:23757686
Sequence length 325
Sequence
MNLDGRVYTSIREKYEELYPAELHQPLAARKHHQLGIHPWRPPPLPLSASPSLRSPPPPP
WPPPSPPPPPSACPLRRAPRPLAVAAFKKLSEASPVPIPPEPTQPLLDEGALPPKPGVYG
VYDAAGDLQFVGISRNVRASLEGHRRKVPADLCASVKVAVADEETPDRAVLSNAWKSWME
EHIESTGKAPPGNVAGNSTWVGAPQRPPDLRLTPGRHVQLTVPLEQLIDRLVKENKVVAF
IKGSRSAPQCGFSQRVVGILEAHGVDFVTVDVLDEEHNHGLRETLKTYSNWPTFPQVFVG
GELVGGCDIVSSMAEKGELSALFQK
Download sequence
Identical sequences Pavirv00057581m|PACid:23757686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]