SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00058172m|PACid:23780783 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00058172m|PACid:23780783
Domain Number 1 Region: 75-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.89e-33
Family Thioltransferase 0.00019
Further Details:      
 
Domain Number 2 Region: 317-414
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.68e-30
Family Thioltransferase 0.00018
Further Details:      
 
Domain Number 3 Region: 212-311
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.48e-30
Family Thioltransferase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00058172m|PACid:23780783
Sequence length 415
Sequence
EGKTVDTLEGANPASLANKVAKIAGPASVAESAVPASLGVAAGPAVLEKVQELAPRNGSS
AAESTNSDSLPDPLNKRLEQLVNSHPVFLFMKGTPEQPRCGFSRKVVDILKQEGVNFGSF
DILTDNDVREGMKKFSNWPTFPQLYCKGELLGGCDIVIAMHDSGELKDVFEEHNIPFKPQ
GSKSIEAVEPEAPSGKAGAVSEPVGLTDAQKARLASLVNSSPVMVFIKGSPEEPKCGFSG
KLVHILKQENIPFSSFDILSDDEVRQGLKVFSNWPSYPQLYIKGELIGGSDIVMEMHKSG
ELEKVLSEKGVIAKVTLEDRLKALISSAPVMLFMKGTPDAPRCGFSSKVVNALKKEGISF
GSFDILSDEEVRQGLKTYSNWPTFPQLYYKSELIGGCDIILEMEKSGELKLTLSE
Download sequence
Identical sequences Pavirv00058172m|PACid:23780783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]