SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00059632m|PACid:23776324 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00059632m|PACid:23776324
Domain Number 1 Region: 132-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-29
Family B3 DNA binding domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily DNA-binding domain 1.18e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00059632m|PACid:23776324
Sequence length 314
Sequence
LPSSKYKGVVPQPNGRWGAQIYERHQRVWLGTFTGEAEAARAYDVAAQRFRGRDAVTNFR
PLSESDPESAAELRFLASRSKAEVVDMLRKHTYLEELAQNRRAFAAASPSPPPKNPASSP
PSAASAAAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPAAASVTGECKGVLLN
FEDAAGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSAGKQLFIDCKVR
PKTTSFANAATTPPHAVKAVRLFGVDLLTPPKPTVAPEQEEMLPMMTNKRARDAIAASTP
HMIFKKQCIDFALT
Download sequence
Identical sequences Pavirv00059632m|PACid:23776324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]