SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00060881m|PACid:23760060 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00060881m|PACid:23760060
Domain Number 1 Region: 86-245
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.84e-40
Family Glutathione peroxidase-like 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00060881m|PACid:23760060
Sequence length 253
Sequence
VLPARGYHSRGYSSGESSKYSRPMRQFSEQNESSPRPLIYYIAPSALLCFAGLAAFVHYN
DERRAVPLAKGGGQTSVPKRCTTNRPAIGGPFKLYDTENNVVTESKLRGNWTLMYFGYTS
CPDVGPAEVQKIADVIKLLESKNVIKITPLFITIDPQRDSPAQLKAYLSEFDPRIVGLTG
PSSAVRQIAQEYRVFFKRVEEVGQDYLVESSHNMYLLDPCLETVRCFGVEYEASDLAEAI
TTEVKKASASSTN
Download sequence
Identical sequences Pavirv00060881m|PACid:23760060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]