SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00061606m|PACid:23801361 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00061606m|PACid:23801361
Domain Number 1 Region: 65-256
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.95e-68
Family Glutathione peroxidase-like 0.000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00061606m|PACid:23801361
Sequence length 258
Sequence
MACSFAAAAATVSSAPTHAARALAAAPQSVSVARSATARPLRLAASRSARAIRLVARAGG
VDDLPLVGNKAPDFQAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSD
RYEEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIP
DQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQENPDEVCPAGWKPG
ERSMKPDPKGSKEYFAAI
Download sequence
Identical sequences Pavirv00061606m|PACid:23801361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]