SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00062235m|PACid:23791761 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00062235m|PACid:23791761
Domain Number 1 Region: 166-295
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.42e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 83-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.75e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00062235m|PACid:23791761
Sequence length 301
Sequence
MTTYKHLKSLDQRKGDPISDVTLSTEQMDRFLGQPRSPEVQNHRCFGSPSPACLPATPSS
CVAMAAAAAKEALPPALGSTSQPPPVFDGTTRLYICYFCPFAQRAWVTRNFKGLQDKIEL
VAIDLQDKPAWYKEKVYPQGTVPSLEHNNEIRGESLDLIRYIDSNFDGPALLPEDAAKRQ
FADELIAYADAFTKALYSPLMAHADVSDEVVAALDKLEAALSKFNDGPFFLGQLSLADIA
YVTILERVQIYYSHLRNYDIAKGRPNLEKFIEEMNKIDAYTQTKNNPLFLLDLAKNHLKI
A
Download sequence
Identical sequences Pavirv00062235m|PACid:23791761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]