SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00063260m|PACid:23802097 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00063260m|PACid:23802097
Domain Number 1 Region: 77-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000253
Family Glutathione peroxidase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00063260m|PACid:23802097
Sequence length 250
Sequence
MATAISLRGAPPAAPRARNSGRLVRVSPPRGGARVGRRSLTRCVSAAAADSSGLAPVAGA
PAWDALGGVSVLAAGTGDAVPLTDLWDPTEGVAVVALLRHFGCFCCWELASVLKDSMEKF
DAAGAKLIAIGVGTPDKARILADRLPFPVDSLYADPDRKAYNVLGLYHGLGRTLFSPSSA
KIYSRLDYIKKATKNYTLEGTPNDLTGVLQQGGMFVFRGKELLYSWKDEGTGDHAPLDDV
LSACRNVPIA
Download sequence
Identical sequences Pavirv00063260m|PACid:23802097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]