SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00063261m|PACid:23802098 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00063261m|PACid:23802098
Domain Number 1 Region: 84-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000178
Family Glutathione peroxidase-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00063261m|PACid:23802098
Sequence length 259
Sequence
MAAPVPASLAPRVSLPPRARSTASSSRGLGLASLPGRRRRHRHRHLRLRRSPSPAGTAAA
SSASAPSPSGIGDALGGVEIYSAATGEPVVFRDLWDQNEGMAVVALLRHFGCPCCWELAA
VLRDTKERFDSAGVKLIAVGVGTSAKARILADRLPFLLEYLYADPERKAYDLLGLYFGIG
RTFFNPASVKVFSRFDSLREAVKNYTIDATPDDRAGVLQQGGMFVFKGKELLYARKDEGT
GDHAPLDDVLNICCKVPVA
Download sequence
Identical sequences Pavirv00063261m|PACid:23802098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]