SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00063542m|PACid:23783590 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00063542m|PACid:23783590
Domain Number 1 Region: 63-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.57e-35
Family Glutathione peroxidase-like 0.00000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00063542m|PACid:23783590
Sequence length 228
Sequence
MAAAATASLLTVSPAACKRFVLSSPSLSFSSHRPAAPAGPGLRLRAAASRAARRRRASRV
AATIAVGDKLPDATLSYFDPADGELRTVTVGELTAGKKAVLFAVPGAFTPTCSQKHLPGF
VEKAAELRAKGVDTLACVSVNDAFVMKAWGEALGVAGPDAVLMLSDGNLELTRALGVEMD
LSDKPVGLGVRSRRYALLAEDGVVKVLNLEDGGAFTSSSAEDMLQALG
Download sequence
Identical sequences Pavirv00063542m|PACid:23783590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]