SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00064193m|PACid:23769819 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00064193m|PACid:23769819
Domain Number 1 Region: 62-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.38e-22
Family Glutathione peroxidase-like 0.00037
Further Details:      
 
Domain Number 2 Region: 216-322
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000173
Family Glutathione peroxidase-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00064193m|PACid:23769819
Sequence length 433
Sequence
MAERAIGDILATGDRDFLVRNSGEQVTLNLHLASCICLNFSRHLPTVALPLHDPGHSAIL
QVKISSIQASSVALYFSALWCPPCRRFTPKLVQVYEQLTTQDRSLEVVFVSCDRDEESFN
AYFAKMPWLAVPFSDSDCLQRLNKRYKVNGIPNLVILSGETGEIYTKEGVKFISDYGVGA
SPFTLERINELKEQEKAAKDNQTVHSVLGTHTRDYLISSTGDKVPISELEGKYVALFFVV
RPIDEFTAVLTKIYEKLKEVGEKFEVVAVYFNNDESVFNESFASMPWLAIPHGDEVCDKL
VRYFELRTLPTLVLIGPDGKTLNNNIADVIEEHGLEAWEGFPFSAEKLETFTEKSKAKEA
SQTLESLLVKDHLNFVIGKDGAKVYARSTLLKIARLPYPAGDAAAASSHWVCCAVPKNVR
PPYLLETATEPSN
Download sequence
Identical sequences Pavirv00064193m|PACid:23769819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]