SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00064194m|PACid:23769818 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00064194m|PACid:23769818
Domain Number 1 Region: 392-501
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.4e-25
Family Glutathione peroxidase-like 0.00072
Further Details:      
 
Domain Number 2 Region: 83-181
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-20
Family Glutathione peroxidase-like 0.00045
Further Details:      
 
Domain Number 3 Region: 531-589
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-16
Family C1-like domain 0.00035
Further Details:      
 
Domain Number 4 Region: 228-339
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000941
Family Glutathione peroxidase-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00064194m|PACid:23769818
Sequence length 619
Sequence
PAPVPRSCSTRSSAPAPALLSPVPSESERKTAAQRAADGGGGAHHQRRQRHRGHPRRRRP
GLPRPQLRRAGEDQQHRGEPCGPLLLRISASWCPPCRRFTPKLIELYKELASQGKSFEVV
FVSGDQDEEAFNAYFGKMPWLAVPFSDSEGREGLDGRFKVSGIPHLVILDAKTGEVYTED
GVEFVSEYGVEAYPFTPERINELKEQEKAAKDNQTIQSVLGTSTRDYLISNKGDKVPISE
LEGKYVGLCFVVGGYGPVDEFTAVLAKIYEKLKEVGEKFEVVAVSLDSDESSFNESFAKM
PWLAIPQGDKICEKLVRYFELRSLPTLVLIGTDGKTLNTNVADIIEEHGFEVWEGFPFSS
EKLEILAEKAKAKAASQTLESLLISGDLDFVIGKDGTKVPVSKLVGKTVLLYFSAKWCGP
CRAFLPTLVKEYNKIKEKHSDFEIVFISSDRDQSSFDEFFSEMPWLALPLEDDRKAFLKK
TFRIRGIPSLVAIGPTGQTVSKDAKAQLMIHGADAFPFTEVRLEELQKELDEMAKGWPEK
LKHALHEEHELVLLRRGTYGCDECEEMGSTWSYRCDECDFDLHPKCALAEEKKGEEEDGK
AAEEAPAGYVCEGDVCRKA
Download sequence
Identical sequences Pavirv00064194m|PACid:23769818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]