SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00064673m|PACid:23810942 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00064673m|PACid:23810942
Domain Number 1 Region: 281-373
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.32e-18
Family Thioltransferase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00064673m|PACid:23810942
Sequence length 428
Sequence
MGCISSKLLPPGPGGRVDHVVSLTSTTYGVLDLHPKHGAAAAPAAAPEERGEEKELPPPP
LPPDKPISKERKRASMRPPPLVVPAADKKPPPAAGKPEAGLEVINAWEIMAGLEEDSAAG
SPAKKPSKPGRWSPARVLAMALPSPKRSAARRRNTPGKENSPLQRCSGNNNGTKEKPGDG
DSDRVLRPYNSIDNSKLSMASRKFSPGSARVVRKRGTAETGGGMSSSRRSLSPLFDPELL
ASIERELSEEGAHIKRMVGSEKPRHPKAAPPAIVAEGKCPPGGADAVVLYTTTLRGIRRT
FEECNAVREAIEAHDVKVIERDVSMDSGYREELRLLLGGRELRVPAVFVRGRHVGGAAEV
AKLEEGKLKALLEGLPRARVWCAGCAGVRFVMCRDCNGSRKVLDAERRETVQCGECNENG
LVRCPICS
Download sequence
Identical sequences Pavirv00064673m|PACid:23810942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]