SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00065700m|PACid:23770409 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00065700m|PACid:23770409
Domain Number 1 Region: 142-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.25e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 261-316
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000213
Family Thioltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00065700m|PACid:23770409
Sequence length 360
Sequence
MHMQSMAPAAAPPAAPLLRPRRPASASAAAARARATSLVAVRAQPDTAATSAPDPPPEFK
PPQGFQPPEPKRFAVKEGQQGSVLGASLAIPLRLGTGVFVLGYSPSLVSPSEIPSDQYAL
EFGAWKVKEESKIGQCKRPEKPIEIYEFEGCPFCRKVREMVSVLDLDVLFYPCPQKGPTF
RPKVLEMGGKKQFPYMVDPNTGVAMYESDDIIKYLADTYGDGTVPIMLSLGLLTAITAGL
ATLGRIGKGNSYTASKVPPQPIEIWAYEGSPFCRLVRETLVELELPHLLHSCARGSPKRQ
EFFKKMGTFQVCIVAVDPLNAEHSSFGCLLGDICMYYCLGRRLTSKIQTPESRCSRALKS
Download sequence
Identical sequences Pavirv00065700m|PACid:23770409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]