SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00065702m|PACid:23770411 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00065702m|PACid:23770411
Domain Number 1 Region: 142-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.13e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00065702m|PACid:23770411
Sequence length 324
Sequence
MHMQSMAPAAAPPAAPLLRPRRPASASAAAARARATSLVAVRAQPDTAATSAPDPPPEFK
PPQGFQPPEPKRFAVKEGQQGSVLGASLAIPLRLGTGVFVLGYSPSLVSPSEIPSDQYAL
EFGAWKVKEESKIGQCKRPEKPIEIYEFEGCPFCRKVREMVSVLDLDVLFYPCPQKGPTF
RPKVLEMGGKKQFPYMVDPNTGVAMYESDDIIKYLADTYGDGTVPIMLSLGLLTVSNYMF
RSIRYALAQHTHQSTSICPIKQLSKNKLHDLIECPIIQEYMARLFLSLYMLQFFFSNLAI
QVLYYLPVISYSVVQFLELCTHCL
Download sequence
Identical sequences Pavirv00065702m|PACid:23770411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]