SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00066293m|PACid:23786558 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00066293m|PACid:23786558
Domain Number 1 Region: 128-226
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.48e-23
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00066293m|PACid:23786558
Sequence length 259
Sequence
MASAASSRCSGVLLPPNLAGARCCPRPSSSLRFRSRSARRRPGTLACVAPPDSAEQQTDE
QTVKAESTVGEAQTTSTSQDAGLPALPNKDLNRRVALLSTLGAVALFGSQRLNLTEASLK
DLAANSVPYEEALSNGKPTVVEFYADWCEVCRELAPDIYQVEQQYKDRVNFVMFNVDNTK
WEQELDEFGVEGIPHFAFLDKEGNEEGNVVGRLPKQYFLDNVVALASGDSNIPHARVVGQ
FSSAESRKVHQVADPRSHG
Download sequence
Identical sequences Pavirv00066293m|PACid:23786558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]