SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00066571m|PACid:23776025 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00066571m|PACid:23776025
Domain Number 1 Region: 280-353
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000164
Family Thioltransferase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00066571m|PACid:23776025
Sequence length 371
Sequence
MATISAALAISFLPSPTRLPVPTTASPSSRIKRTARFRCCAEPSSQEQDTAAAPPTLPPA
KESTSSLLGISTSTWSAGVAGLGFLETGYLTYLKLTGSEAFCPISGGGCGDVLDSDYSAV
FGIPLPLVGLVAYGLVTALSLQENGTDLLPGLYDLDIQLTLLLIATSMATASAYFLYILS
TKFVGVSCSYCLLSAVLSFTLLFIRVKDFGFERIQKFAGIQLAVVVIIALALTNSYGSAT
TQLKGTDDFVLEPYETEITTESSPFAISLARHLHSIGAKMYGAFWCSHCNEQKQMFGREA
TKILDYVECFPNGAGKGKKMSSECQAAGLEGFPTWFINGKVLSGDQELEVLAEASGFVAE
GTEQSKEIAPN
Download sequence
Identical sequences Pavirv00066571m|PACid:23776025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]