SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00067463m|PACid:23788536 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00067463m|PACid:23788536
Domain Number 1 Region: 53-257
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.07e-35
Family Thioltransferase 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00067463m|PACid:23788536
Sequence length 260
Sequence
AITGVWGERRKESPLCLCMPSRLLLSVRIPSPAKPSALRCTKLMASDMGRKLMQIDVSSD
TVCPWCFVGKKNLERAMEQTMDKYNFEVRWHPFFLNPDAPKEGVRKSDFYKMKFGPVQFE
RATSRMTEIFRGLGFEFDMSGLTGNTMDSHRLITLAGHQGYDKQNALVEELFQSYFCQGK
YIGDKQVLLDVARKVGIEGAEELLEDPSRGVDEVQEELNKYSSAISGIPHFVINGKYQLS
GGQPPSIFMKVFEMAAKDEA
Download sequence
Identical sequences Pavirv00067463m|PACid:23788536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]