SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00067647m|PACid:23777800 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00067647m|PACid:23777800
Domain Number 1 Region: 311-367
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000123
Family NQO2-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00067647m|PACid:23777800
Sequence length 405
Sequence
MELAGAALRRSLPSASPAAGRGRAPAARVACVGGGVFAEEGHLRYYEAAAPRRKAVEAVA
RDLVRLRAMGLVAGDAAKEKVLSEATDLLLQELTQMNDEEYKMKKAQKEEKASMKALKKQ
QKEAKKAAMMNCQDESSSESSESDCEDEATTNFEQGMVISAAVPEAVGSGISTVSGMECE
NAAMKAMKKMEKKQMKAMKKMEKEQKKAAKKAMKMEKEAKKMAMAALNGCRDEDDSSCSS
ESSDSECEGEVVRMSRCATVAAPQMPCPSAVFPVIVPQIPPSLPPEPSLALEPAAAMQVT
SISSVAVAETFTTNRIEVCMGGKCKKSGALALLQEFEKTMGTGGAVVGCKCLGKCGLGPN
VRLGNDVSAEGSAKRNPLCIGVGLDDVGTIVAGLFGDVDPGMTPT
Download sequence
Identical sequences Pavirv00067647m|PACid:23777800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]