SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00068692m|PACid:23785425 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00068692m|PACid:23785425
Domain Number 1 Region: 256-416
Classification Level Classification E-value
Superfamily eEF1-gamma domain 3.4e-61
Family eEF1-gamma domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 80-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.29e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0053
Further Details:      
 
Domain Number 3 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.12e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00068692m|PACid:23785425
Sequence length 416
Sequence
MALVLHAGSGNKNAFKALIAAEYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP
DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFAATEVDANIGKWLYPRMGFY
PYAAVSEETAIAALKRALGSLNTHLASNTFLVGHSVTLADIVLTCNLYLGFIRILTKSFT
TEFPHVERYFWTMVNQPNFKKVIGDVKQAETVPPVQKKAAPAKEQKPKEAKKEAPKEALK
PKADEKPAEEEPKPKPKNPLDLLPPSKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEG
YSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFR
GSEIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK
Download sequence
Identical sequences Pavirv00068692m|PACid:23785425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]