SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00068693m|PACid:23785426 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00068693m|PACid:23785426
Domain Number 1 Region: 204-364
Classification Level Classification E-value
Superfamily eEF1-gamma domain 2.48e-61
Family eEF1-gamma domain 0.0000508
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0046
Further Details:      
 
Domain Number 3 Region: 80-163
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000134
Family Glutathione S-transferase (GST), C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Pavirv00068693m|PACid:23785426
Sequence length 364
Sequence
MALVLHAGSGNKNAFKALIAAEYSGIKVELVKDFQMGVSNKTPEFLKMNPIGKVPVLETP
DGPVFESNAIARYVTRLKADNPLYGSSLIDYAHIEQWMDFAATEVDANIGKWLYPRMGFY
PYAAVSFTTEFPHVERYFWTMVNQPNFKKVIGDVKQAETVPPVQKKAAPAKEQKPKEAKK
EAPKEALKPKADEKPAEEEPKPKPKNPLDLLPPSKMILDDWKRLYSNTKTNFREVAIKGF
WDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFK
VKGLWLFRGSEIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQEPFEGEALLDA
KCFK
Download sequence
Identical sequences Pavirv00068693m|PACid:23785426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]