SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00068747m|PACid:23763436 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00068747m|PACid:23763436
Domain Number 1 Region: 87-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.53e-35
Family Thioltransferase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Pavirv00068747m|PACid:23763436
Sequence length 205
Sequence
MISSNGNWQGARAKRHIRNVVPQDKFDSPNGQISIGTRPEEERETQHNNRIRPSRSSVST
HRVRKKRAVVRARETEMATPATEAATPEAPAEGSVIAIHSLDEWSTNIESANSAKKLVVI
DFTASWCGPCRIMAPIFADLAKKHPNAVFLKVDVDELKAITEQFSVEAMPTFLFMKEGDV
KDRVVGAMKDELVQKLAFHMTHVDQ
Download sequence
Identical sequences Pavirv00068747m|PACid:23763436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]