SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00070036m|PACid:23808535 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00070036m|PACid:23808535
Domain Number 1 Region: 91-192
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000124
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00070036m|PACid:23808535
Sequence length 209
Sequence
MGAAAKPPPSICFKWPWGPNPGPSPDPGPSPCGGLELPWLFKSIRTLARGLVIAGDLPSP
PAPAAGGGGGGRRGWGAVQVEADRGDAEQRALAAALVRGGPATVLEFYSPRCRLCASLQG
LVRELEEEQRAGGAAAFVLADAEDDRWLPELLHYDIRYVPCFVLLDKHGRALAKTGVPTS
RQHVIAGLHHLLKMERPSGHEGNQRVPSS
Download sequence
Identical sequences Pavirv00070036m|PACid:23808535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]