SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Pavirv00070741m|PACid:23821725 from Panicum virgatum v202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Pavirv00070741m|PACid:23821725
Domain Number 1 Region: 76-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.14e-40
Family Glutathione S-transferase (GST), C-terminal domain 0.0004
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.24e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Pavirv00070741m|PACid:23821725
Sequence length 220
Sequence
MSPPVKLIGAFGSPFVHRAEAALRLKGVPYELIQEDMENKSELLLHHNPIHKKVPVLLHG
DRAVCESLLILEYVDEAFDGPPLLPSDPFDRAAARFWADFMEQKFRGPLWLSFWTEGEVK
KGYIKEMKENLALLEAQLDGKRFFGGDSVGYLDIALSGLSHWMGVLEEVAGVSLVGEDEY
PGLHRWAKEYTSDEAVKQCLPNRERLRDKMKMAAMAMLQQ
Download sequence
Identical sequences Pavirv00070741m|PACid:23821725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]